PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21110A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 459aa    MW: 49092.4 Da    PI: 8.2979
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21110AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-165397147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT++E++++++a +++G   W++I  ++g ++t+ q++s+ qk+
  Oropetium_20150105_21110A 53 REKWTEDEHKRFLEALQLHGRA-WRRIQGHIG-TKTAVQIRSHAQKF 97
                               789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1447100IPR009057Homeodomain-like
PROSITE profilePS5129418.49448102IPR017930Myb domain
TIGRFAMsTIGR015572.2E-1551100IPR006447Myb domain, plants
SMARTSM007171.3E-1152100IPR001005SANT/Myb domain
PfamPF002491.1E-135396IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-85393IPR009057Homeodomain-like
CDDcd001676.40E-95598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MTCFETKTMA TDENGENAMD HGNNPPGPGG MDVSGDEHAP KQARKPYTIT KQREKWTEDE  60
HKRFLEALQL HGRAWRRIQG HIGTKTAVQI RSHAQKFFTK VVTLVRESSG SSSGTGAAPA  120
IQIPPPRPKR KPARPYPRKV DGADRKHAPV LKHLEKPQAP GMQSLREQDD GSPTSVLTAA  180
QTVSRADAMG GVFSNTSIGG SRSPAPSVAG SDEHGNGGGS SVDREEDVEA AELAVRASNT  240
KAFSDTKDCT GSEASVFKLF GKKVAVNDSY QHLQNGRNLK MDASPACVTQ TTRSAIPFAG  300
NSWNPWPSNM QQLMYFFPGP DGFAAQSVMP WLGYNGSIPC SLFYPQAVAS NQQNHQHHQL  360
SESPDQREGS LTGSNTGSSV APASAAQNSE AVESHAEQGN ASESVKAPAV KLLSKCPSSA  420
STNRRGFMPY KRCAAESQEP RSVAPGEEAD GELTRLCL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953478.10.0PREDICTED: protein REVEILLE 2-like isoform X2
TrEMBLK3YSP40.0K3YSP4_SETIT; Uncharacterized protein
STRINGSi017289m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.11e-30MYB_related family protein